GENLISA™ Human Vascular Endothelial Cell Growth Factor (VEGF) ELISA

SKU: KB1155 Category:

28,000.00

GST Applicable
Enzyme Immunoassay for the estimation of Human Vascular Endothelial Cell Growth Factor (VEGF) in human serum, plasma, cell culture supernatant and other biological samples. Validated for citrated/EDTA plasma only.


Availability: 3 – 4 Weeks | Pack Size: 1 x 96 wells





Description

Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-kDa[5] and has 53 amino acid residues and three intramolecular disulfide bonds.
EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets,submandibular gland (submaxillary gland), and parotid gland.Initially, human EGF was known as urogastrone.In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR),with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival.Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents

The GENLISA Human Vascular Endothelial Cell Growth Factor (VEGF) ELISA includes features like:
– Ready to use protocol with break-apart wells for ease of use
– Standardisation and High Reproducibility
– Lot to Lot Consistency
– Accuracy and Precision

Validated against seven points for a “GOLD RING” Standard Quality ELISA – the benchmark sign for Krishgen Quality. The The GENLISA ELISA kits are used for assessing the specific biomarker in samples analytes which may be human serum, plasma, biological fluids and cell culture supernatant. The kit uses indirect sandwich assay with double antibodies – capture and detection to ensure a high degree of sensitivity and specificity in the estimation of Vascular Endothelial Cell Growth Factor (VEGF);









If you have published a paper by using any of our ELISA since 01/01/2023, kindly fill out the “Krishgen Publication Reward Application Form” with complete information and send it by at email: kbiinfo@krishgen.com, with the subject “Krishgen Publication Reward”. We will get back to you with the Amazon / Krishgen Credit Reward after we confirm it ASAP!

View more details about our Publication Reward >>

Additional information

Pack Type

1 x 96 wells, break-apart wells

Species Reactivity

Human

Sample Type

Serum, Plasma, Cell Culture Supernatant and other biological samples. Validated for citrated/EDTA Plasma only.

Assay Range

31.25 – 2000 pg/ml

Sensitivity

18.75 pg/ml

Interference

Preparations of the known factors were assayed for interference. No significant interference was observed.

Specificity

This assay recognises both the recombinant and natural protein for Vascular Endothelial Cell Growth Factor (VEGF)

Principle Of Assay

This ELISA is a sandwich immunoassay . Antibodies are coated on 96 well plates. The antigen protein present in sample and standard respectively bind to the coated wells. The wells are washed and an antibody:HRP Conjugate is added which binds to the bound complex in the well. Washing is performed to remove any unbound material. TMB substrate is added and the enzyme reaction is stopped by dispensing of stop solution into the wells. The optical density (OD) of the solution at 450 nm is directly proportional to the amount of antigen protein present in the standard or samples.

Detection Method

Colorimetric, Absorbance measured at 450nm

Conjugate-Enzyme Reaction

Uses stable HRP Enzyme Conjugate with (single component) TMB Chromogenic Substrate for color development.

Quality Certification

Validated as per KRISHGEN's Quality Program. GOLD PLUS (GOLD+) validation done. The kit is calibrated against NIBSC calibrator.

KRISHGEN Mandate

High Performance Assays at Affordable Prices

Regulatory Status

Research Use Only.

Shipping Temperature

Shipped at Room Temperature or in gel pack to maintain temperature at 2-8 degrees Celsius

Storage Temperature

The kit (2-8 Degree Celsius) and its components are to be stored as indicated in the IFU (instructions for use). To ensure quality of your results, if all the wells in the kit are not being used, store the unused wells in the foil pouch containing the desiccant pack, well sealed and store at the indicated temperature. Similary aliquot and store the reconstituted standard at -20 Degree Celsius for long term storage (maximum 6 months from reconstitution) and to avoid deterioration in the activity.

ELISA Type

Sandwich ELISA, Double Antibody

ELISA Interpretation

Quantitative Results Intepretation, 4PL (2nd order) or Cubic Spline Graph. Software (MS Excel) available, on request, to support interpretation of results.

Shelf Life Available

8 -10 months at time of shipping

Alternate Names / Synonyms

Vascular Endothelial Cell Growth Factor (VEGF);

Research Area

Immune molecule

Disclaimer

The data indicated herein with specifications are changed from time to time at time of production of the assay. We request you to confirm the specifications including the assay range and procedure as per the most current IFU (instructions for use) accompanying the assay kit.

Citations